OK: Found an XML parser.
OK: Support for GZIP encoding.
OK: Support for character munging.

Warning: Cache couldn't make dir './cache'. in /home/kalyanvarma/public_html/includes/rss_cache.inc on line 185

Warning: MagpieRSS [debug] Cache couldn't make dir './cache'. in /home/kalyanvarma/public_html/includes/rss_fetch.inc on line 243

Notice: MagpieRSS [debug] Cache doesn't contain: http://feeds.feedburner.com/FirstmediamarketingUTF-8 (cache file: ./cache/1feae637cf399249ded52611142a97d1) in /home/kalyanvarma/public_html/includes/rss_cache.inc on line 185

Notice: MagpieRSS [debug] Cache doesn't contain: http://feeds.feedburner.com/FirstmediamarketingUTF-8 (cache file: ./cache/1feae637cf399249ded52611142a97d1) in /home/kalyanvarma/public_html/includes/rss_cache.inc on line 185

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Deprecated: Function split() is deprecated in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 153

Notice: Undefined index: description in /home/kalyanvarma/public_html/includes/rss_parse.inc on line 402

Warning: Cache unable to open file for writing: ./cache/1feae637cf399249ded52611142a97d1 in /home/kalyanvarma/public_html/includes/rss_cache.inc on line 185

Example Output

Channel: First Media Marketing

RSS URL:

Parsed Results (var_dump'ed)

object(MagpieRSS)#3 (23) {
  ["parser"]=>
  resource(9) of type (Unknown)
  ["current_item"]=>
  array(0) {
  }
  ["items"]=>
  array(10) {
    [0]=>
    array(11) {
      ["title"]=>
      string(94) "Chris Evans y Dwayne Johnson actuarán juntos en “Red One”, una cinta navideña de acción"
      ["link"]=>
      string(117) "https://firstmediamarketing.com/chris-evans-y-dwayne-johnson-actuaran-juntos-en-red-one-una-cinta-navidena-de-accion/"
      ["dc"]=>
      array(1) {
        ["creator"]=>
        string(12) "Sally Scully"
      }
      ["pubdate"]=>
      string(31) "Thu, 27 Jan 2022 07:40:36 +0000"
      ["category"]=>
      string(74) "CelebrityacciónactuaránChrisCintaDwayneEvansJohnsonjuntosnavideñaReduna"
      ["guid"]=>
      string(40) "https://firstmediamarketing.com/?p=10076"
      ["description"]=>
      string(717) "La película con Evans y Johnson formará parte del catálogo original de Amazon Prime Video. (AFP) Red One acumula más rostros de Hollywood en su elenco principal, Chris Evans se sumó a Dwayne Johnson en la próxima película navideña de acción para Amazon Prime Video. Bajo la dirección de Jake Kasdan (Jumanji), el proyecto se ... Read more"
      ["content"]=>
      array(1) {
        ["encoded"]=>
        string(7896) "
La película con Evans y Johnson formará parte del catálogo original de Amazon Prime Video. (AFP)

Red One acumula más rostros de Hollywood en su elenco principal, Chris Evans se sumó a Dwayne Johnson en la próxima película navideña de acción para Amazon Prime Video. Bajo la dirección de Jake Kasdan (Jumanji), el proyecto se gestó a partir de una historia original de Hiram García, presidente de producción en Seven Bucks Productions, después de ser adquirido por la plataforma digital en una reñida competencia de ofertas.

El rodaje se llevará a cabo este año con el cineasta estadounidense liderando la producción y con el guion de Chris Morgan, escritor de películas que ha trabajado antes con Seven Bucks Productions para filmes de la franquicia cinematográfica Rápidos y furiosos. La historia está descrita como una comedia de acción y aventuras que explorará un nuevo universo en el género navideño en el cine.

Johnson y los representantes de Seven Bucks Productions, Hiram y Dany García, estarán encargados de producir el filme original de Amazon. Asimismo, Jake Kasdan tendrá crédito como productor a través de su compañía, The Detective Agency, junto a Melvin Mar y Sky Salem Robinson y Chris Morgan.

[Más series y películas que te recomendamos en Qué puedo ver]
El actor estadounidense Chris Evans dio vida al Capitán América en diversas cintas. (EFE/HANNAH MCKAY)
El actor estadounidense Chris Evans dio vida al Capitán América en diversas cintas. (EFE/HANNAH MCKAY)

Johnson y Evans compartirán un protagónico por primera vez

En junio del año pasado, Dwayne Johnson confirmó estar involucrado en el título que espera estrenarse en diciembre de 2023. El actor, también conocido como La Roca, trabajará nuevamente con Kasdan después de actuar en Jumanji: en la selva (2017) y Jumanji: el siguiente nivel (2019), entregas que protagonizó junto a Karen Gillan, Kevin Hart y Jack Black. Recientemente, celebró el éxito de Alerta roja, la cinta más vista en Netflix hasta la fecha y también la más cara en toda la historia del servicio streaming.

Por su parte, Chris Evans cerró una etapa como Capitán América con Avengers: Endgame, y se aventuró en otros exitosos títulos como Knives Out, Free Guy y próximamente dará voz a Buzz Lightyear en el filme animado de Pixar, así como también volverá a ser dirigido por los hermanos Russo para The Gray Man, una historia de espías. Además, se confirmó que protagonizará y producirá una biopic del veterano actor Gene Kelly que aún se encuentra en desarrollo.

A finales de 2021, "La Roca" protagonizó "Alerta roja", la exitosa película de Netflix, junto a Gal Gadot y Ryan Reynolds. (REUTERS/Mike Blake)
A finales de 2021, “La Roca” protagonizó “Alerta roja”, la exitosa película de Netflix, junto a Gal Gadot y Ryan Reynolds. (REUTERS/Mike Blake)

En la comedia de Shawn Levy con Ryan Reynolds, ambas estrellas formaron parte del reparto, pero nunca antes habían coprotagonizado una propuesta para el cine. Red One será la primera en juntarlos para trabajar codo a codo, y solo se podrá ver desde Amazon Prime Video en 2033.

SEGUIR LEYENDO:

As We See It: la vida cotidiana de tres jóvenes que reflejan cómo es vivir con autismo
Nicole Kidman viaja a los 50 y revive a Lucille Ball en un detrás de escena de I love Lucy
Amazon Prime anunció el título oficial de la serie de El señor de los anillos

We would like to give thanks to the writer of this write-up for this amazing content

Chris Evans y Dwayne Johnson actuarán juntos en “Red One”, una cinta navideña de acción

" } ["summary"]=> string(717) "La película con Evans y Johnson formará parte del catálogo original de Amazon Prime Video. (AFP) Red One acumula más rostros de Hollywood en su elenco principal, Chris Evans se sumó a Dwayne Johnson en la próxima película navideña de acción para Amazon Prime Video. Bajo la dirección de Jake Kasdan (Jumanji), el proyecto se ... Read more" ["atom_content"]=> string(7896) "
La película con Evans y Johnson formará parte del catálogo original de Amazon Prime Video. (AFP)

Red One acumula más rostros de Hollywood en su elenco principal, Chris Evans se sumó a Dwayne Johnson en la próxima película navideña de acción para Amazon Prime Video. Bajo la dirección de Jake Kasdan (Jumanji), el proyecto se gestó a partir de una historia original de Hiram García, presidente de producción en Seven Bucks Productions, después de ser adquirido por la plataforma digital en una reñida competencia de ofertas.

El rodaje se llevará a cabo este año con el cineasta estadounidense liderando la producción y con el guion de Chris Morgan, escritor de películas que ha trabajado antes con Seven Bucks Productions para filmes de la franquicia cinematográfica Rápidos y furiosos. La historia está descrita como una comedia de acción y aventuras que explorará un nuevo universo en el género navideño en el cine.

Johnson y los representantes de Seven Bucks Productions, Hiram y Dany García, estarán encargados de producir el filme original de Amazon. Asimismo, Jake Kasdan tendrá crédito como productor a través de su compañía, The Detective Agency, junto a Melvin Mar y Sky Salem Robinson y Chris Morgan.

[Más series y películas que te recomendamos en Qué puedo ver]
El actor estadounidense Chris Evans dio vida al Capitán América en diversas cintas. (EFE/HANNAH MCKAY)
El actor estadounidense Chris Evans dio vida al Capitán América en diversas cintas. (EFE/HANNAH MCKAY)

Johnson y Evans compartirán un protagónico por primera vez

En junio del año pasado, Dwayne Johnson confirmó estar involucrado en el título que espera estrenarse en diciembre de 2023. El actor, también conocido como La Roca, trabajará nuevamente con Kasdan después de actuar en Jumanji: en la selva (2017) y Jumanji: el siguiente nivel (2019), entregas que protagonizó junto a Karen Gillan, Kevin Hart y Jack Black. Recientemente, celebró el éxito de Alerta roja, la cinta más vista en Netflix hasta la fecha y también la más cara en toda la historia del servicio streaming.

Por su parte, Chris Evans cerró una etapa como Capitán América con Avengers: Endgame, y se aventuró en otros exitosos títulos como Knives Out, Free Guy y próximamente dará voz a Buzz Lightyear en el filme animado de Pixar, así como también volverá a ser dirigido por los hermanos Russo para The Gray Man, una historia de espías. Además, se confirmó que protagonizará y producirá una biopic del veterano actor Gene Kelly que aún se encuentra en desarrollo.

A finales de 2021, "La Roca" protagonizó "Alerta roja", la exitosa película de Netflix, junto a Gal Gadot y Ryan Reynolds. (REUTERS/Mike Blake)
A finales de 2021, “La Roca” protagonizó “Alerta roja”, la exitosa película de Netflix, junto a Gal Gadot y Ryan Reynolds. (REUTERS/Mike Blake)

En la comedia de Shawn Levy con Ryan Reynolds, ambas estrellas formaron parte del reparto, pero nunca antes habían coprotagonizado una propuesta para el cine. Red One será la primera en juntarlos para trabajar codo a codo, y solo se podrá ver desde Amazon Prime Video en 2033.

SEGUIR LEYENDO:

As We See It: la vida cotidiana de tres jóvenes que reflejan cómo es vivir con autismo
Nicole Kidman viaja a los 50 y revive a Lucille Ball en un detrás de escena de I love Lucy
Amazon Prime anunció el título oficial de la serie de El señor de los anillos

We would like to give thanks to the writer of this write-up for this amazing content

Chris Evans y Dwayne Johnson actuarán juntos en “Red One”, una cinta navideña de acción

" ["date_timestamp"]=> int(1643269236) } [1]=> array(11) { ["title"]=> string(45) "Integrated photonics for quantum technologies" ["link"]=> string(78) "https://firstmediamarketing.com/integrated-photonics-for-quantum-technologies/" ["dc"]=> array(1) { ["creator"]=> string(12) "Tony Grantly" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 07:23:39 +0000" ["category"]=> string(56) "Health And ScienceIntegratedphotonicsquantumtechnologies" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10071" ["description"]=> string(693) "Journal Reference: Emanuele Pelucchi, Giorgos Fagas, Igor Aharonovich, Dirk Englund, Eden Figueroa, Qihuang Gong, Hübel Hannes, Jin Liu, Chao-Yang Lu, Nobuyuki Matsuda, Jian-Wei Pan, Florian Schreck, Fabio Sciarrino, Christine Silberhorn, Jianwei Wang, Klaus D. Jöns. The potential and global outlook of integrated photonics for quantum technologies. Nature Reviews Physics, 2021; DOI: 10.1038/s42254-021-00398-z “Photonic quantum technologies ... Read more" ["content"]=> array(1) { ["encoded"]=> string(3897) "

Journal Reference:

  1. Emanuele Pelucchi, Giorgos Fagas, Igor Aharonovich, Dirk Englund, Eden Figueroa, Qihuang Gong, Hübel Hannes, Jin Liu, Chao-Yang Lu, Nobuyuki Matsuda, Jian-Wei Pan, Florian Schreck, Fabio Sciarrino, Christine Silberhorn, Jianwei Wang, Klaus D. Jöns. The potential and global outlook of integrated photonics for quantum technologies. Nature Reviews Physics, 2021; DOI: 10.1038/s42254-021-00398-z

“Photonic quantum technologies have reached a number of important milestones over the last 20 years. However, scalability remains a major challenge when it comes to translating results from the lab to everyday applications. Applications often require more than 1,000 optical components, all of which have to be individually optimised. Photonic quantum technologies can, though, benefit from the parallel developments in classical photonic integration,” explains Jöns. According to the scientists, more research is required. “The integrated photonic platforms, which require a variety of multiple materials, component designs and integration strategies, bring multiple challenges, in particular signal losses, which are not easily compensated for in the quantum world,” continues Jöns. In their paper, the authors state that the complex innovation cycle for integrated photonic quantum technologies (IPQT) requires investments, the resolution of specific technological challenges, the development of the necessary infrastructure and further structuring towards a mature ecosystem. They conclude that there is an increasing demand for scientists and engineers with substantial knowledge of quantum mechanics and its technological applications.

Integrated quantum photonics uses classical integrated photonic technologies and devices for quantum applications, whereby chip-level integration is critical for scaling up and translating laboratory demonstrators to real-life technologies. Jöns explains: “Efforts in the field of integrated quantum photonics are broad-ranging and include the development of quantum photonic circuits, which can be monolithically, hybrid or heterogeneously integrated. In our paper, we discuss what applications may become possible in the future by overcoming the current roadblocks.” The scientists also provide an overview of the research landscape and discuss the innovation and market potential. The aim is to stimulate further research and research funding by outlining not only the scientific issues, but also the challenges related to the development of the necessary manufacturing infrastructure and supply chains for bringing the technologies to market.

According to the scientists, there is an urgent need to invest heavily in education in order to train the next generation of IPQT engineers. Jöns says: “Regardless of the type of technology that will be used in commercial quantum devices, the underlying principles of quantum mechanics are the same. We predict an increasing demand for scientists and engineers with substantial knowledge of both quantum mechanics and its technological applications. Investing in educating the next generation will contribute to pushing the scientific and technological frontiers.”

We would like to give thanks to the author of this post for this remarkable material

Integrated photonics for quantum technologies

" } ["summary"]=> string(693) "Journal Reference: Emanuele Pelucchi, Giorgos Fagas, Igor Aharonovich, Dirk Englund, Eden Figueroa, Qihuang Gong, Hübel Hannes, Jin Liu, Chao-Yang Lu, Nobuyuki Matsuda, Jian-Wei Pan, Florian Schreck, Fabio Sciarrino, Christine Silberhorn, Jianwei Wang, Klaus D. Jöns. The potential and global outlook of integrated photonics for quantum technologies. Nature Reviews Physics, 2021; DOI: 10.1038/s42254-021-00398-z “Photonic quantum technologies ... Read more" ["atom_content"]=> string(3897) "

Journal Reference:

  1. Emanuele Pelucchi, Giorgos Fagas, Igor Aharonovich, Dirk Englund, Eden Figueroa, Qihuang Gong, Hübel Hannes, Jin Liu, Chao-Yang Lu, Nobuyuki Matsuda, Jian-Wei Pan, Florian Schreck, Fabio Sciarrino, Christine Silberhorn, Jianwei Wang, Klaus D. Jöns. The potential and global outlook of integrated photonics for quantum technologies. Nature Reviews Physics, 2021; DOI: 10.1038/s42254-021-00398-z

“Photonic quantum technologies have reached a number of important milestones over the last 20 years. However, scalability remains a major challenge when it comes to translating results from the lab to everyday applications. Applications often require more than 1,000 optical components, all of which have to be individually optimised. Photonic quantum technologies can, though, benefit from the parallel developments in classical photonic integration,” explains Jöns. According to the scientists, more research is required. “The integrated photonic platforms, which require a variety of multiple materials, component designs and integration strategies, bring multiple challenges, in particular signal losses, which are not easily compensated for in the quantum world,” continues Jöns. In their paper, the authors state that the complex innovation cycle for integrated photonic quantum technologies (IPQT) requires investments, the resolution of specific technological challenges, the development of the necessary infrastructure and further structuring towards a mature ecosystem. They conclude that there is an increasing demand for scientists and engineers with substantial knowledge of quantum mechanics and its technological applications.

Integrated quantum photonics uses classical integrated photonic technologies and devices for quantum applications, whereby chip-level integration is critical for scaling up and translating laboratory demonstrators to real-life technologies. Jöns explains: “Efforts in the field of integrated quantum photonics are broad-ranging and include the development of quantum photonic circuits, which can be monolithically, hybrid or heterogeneously integrated. In our paper, we discuss what applications may become possible in the future by overcoming the current roadblocks.” The scientists also provide an overview of the research landscape and discuss the innovation and market potential. The aim is to stimulate further research and research funding by outlining not only the scientific issues, but also the challenges related to the development of the necessary manufacturing infrastructure and supply chains for bringing the technologies to market.

According to the scientists, there is an urgent need to invest heavily in education in order to train the next generation of IPQT engineers. Jöns says: “Regardless of the type of technology that will be used in commercial quantum devices, the underlying principles of quantum mechanics are the same. We predict an increasing demand for scientists and engineers with substantial knowledge of both quantum mechanics and its technological applications. Investing in educating the next generation will contribute to pushing the scientific and technological frontiers.”

We would like to give thanks to the author of this post for this remarkable material

Integrated photonics for quantum technologies

" ["date_timestamp"]=> int(1643268219) } [2]=> array(11) { ["title"]=> string(119) "Zonder ingrijpen geen geld op boerenerf – Natuurinclusieve landbouw redt het niet in het consumentenbrein – Foodlog" ["link"]=> string(144) "https://firstmediamarketing.com/zonder-ingrijpen-geen-geld-op-boerenerf-natuurinclusieve-landbouw-redt-het-niet-in-het-consumentenbrein-foodlog/" ["dc"]=> array(1) { ["creator"]=> string(12) "Paula Hooper" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 07:01:53 +0000" ["category"]=> string(99) "LifestyleboerenerfconsumentenbreinFoodloggeengeldhetingrijpenlandbouwNatuurinclusievenietredtZonder" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10065" ["description"]=> string(850) "Iedereen heeft de mond vol van natuurinclusieve landbouw. Maar wat is het eigenlijk? En hoe belangrijk is natuurinclusieve landbouw in relatie tot het grote VN-doel om in 2030 een klimaat neutrale landbouw te realiseren? Is het haalbaar, schaalbaar en betaalbaar? Serie artikelen Vier (oud)-lectoren van HAS Hogeschool, 1 professor van Wageningen University en 1 HAS-alumnus ... Read more" ["content"]=> array(1) { ["encoded"]=> string(14214) "

Iedereen heeft de mond vol van natuurinclusieve landbouw. Maar wat is het eigenlijk? En hoe belangrijk is natuurinclusieve landbouw in relatie tot het grote VN-doel om in 2030 een klimaat neutrale landbouw te realiseren? Is het haalbaar, schaalbaar en betaalbaar?

Serie artikelen
Vier (oud)-lectoren van HAS Hogeschool, 1 professor van Wageningen University en 1 HAS-alumnus (winnaar HAS Foodmanship award en lid Food100) gaan op zoek naar opiniërende antwoorden in een serie van 6 artikelen. Erwin van Woudenberg, Daan Groot, Harry van Delft, Roger Engelberts, Ruben Burger en Martin Scholten gaan de challenge aan en kijken ieder vanuit hun eigen perspectief naar het vraagstuk. De uitdaging: kan Nederland GIDS-land worden met natuurinclusieve landbouw, waarbij een goed verdienmodel voor de boer centraal staat? Erwin van Woudenberg trapt de serie af.

Boeren zijn de ondernemers in de landbouw. Ondernemers moeten geld verdienen om te kunnen blijven bestaan. De toekomst van onze aarde is voor een groot deel afhankelijk van hoe we de aarde gebruiken. Natuurinclusief boeren is een manier van landgebruik die zorgt voor een toekomstbestendigere aarde. Toch hebben veel natuurinclusieve boeren het financieel lastig. Ze zorgen beter voor onze aarde, hebben daardoor minder productie en dus een hogere kostprijs per product. De natuurinclusieve boer is echter zelf verantwoordelijk voor de noodzakelijk hogere verkoopprijs per product. Dat is een (te) grote opgave. Het aantal natuurinclusieve boeren blijft dan ook laag.

De natuurinclusieve boer is zelf verantwoordelijk voor de noodzakelijk hogere verkoopprijs per product. Dat is een (te) grote opgave

Wat is natuurinclusieve landbouw? Het is lastig natuurinclusieve landbouw precies te definiëren. Ik ga uit van het volgende: ‘Natuurinclusief boeren is als boer op een zo hoog mogelijk niveau voor de omgeving zorgen en, omdat je zo goed voor de natuur zorgt, de potentieel hoogst mogelijke afzet niet kunnen halen, waardoor je te maken hebt met een hogere kostprijs per product’.
Om maar met de deur in huis te vallen: binnen het huidige systeem gaat dit niet veranderen. Ons systeem is gefocust op marktwerking en stimuleert ondernemers daarbij niet in het realiseren van een beter en mooier Nederland, omdat we ecosysteemdiensten in die markt niet waarderen. Dat is niet omdat boeren niet kunnen of niet willen: ik twijfel er niet aan dat boeren in de rij zullen staan als er een financieel goed alternatief is voor de gangbare landbouw. Het is ook niet dat consumenten niet zouden willen, ik ben er van overtuigd dat mensen het liefst geen enkele negatieve impact op de aarde hebben. Toch lukt het niet. Hoe komt dat? Ik benoem hier vijf redenen waarom de vraag van consumenten naar natuurinclusieve landbouw achterblijft en boeren dus (beter) niet kiezen voor de natuurinclusieve landbouw.

Twee waarheden
De eerste reden is het begrip duurzaamheid. Duurzaamheid is een woord dat alles zegt en daarmee niets zegt. Iedereen verstaat er iets anders onder en tegenwoordig noemen we alles duurzaam. Het is niet simpelweg een kwestie van duurzaam tegenover niet-duurzaam; er zijn honderden manieren waarop we duurzaamheid in kunnen vullen. Toch is de term van groot belang voor de consument, omdat de consument zich goed voelt als hij iets koopt met de kwalificatie ‘duurzaam’. De vragen hoe, wat, waar en waarom doen er dan niet meer toe. Dat het product duurzaam is, is toch mooi meegenomen. In werkelijkheid is het op z’n zachtst gezegd onduidelijk wat de consument nu eigenlijk koopt. Het klinkt in den beginne wellicht als een onbelangrijke kwestie, maar in de wereld van marketing kan het belang van het woord ‘duurzaam’ moeilijk worden onderschat. Het betekent dat je, zolang iedereen een beroep kan doen op de kwalificatie ‘duurzaam’, niet kan verwachten dat de markt gaat veranderen.

Niet alleen in de marketingwereld is onduidelijk wat het betekent om duurzaam te zijn, ook de landbouwwetenschappers komen er niet uit

Binnen de landbouw is het nog iets lastiger. In de landbouw is er al tientallen jaren een stevige discussie gaande tussen twee overtuigingen. Aan de ene kant staan de gangbare en intensieve teelten, met hoge grondstofefficiency, aan de andere kant de extensievere en natuurinclusieve teelten. Mooi verwoordt door Charles Mann in zijn boek ‘De tovenaar en de profeet’, claimen beide kanten het meest duurzaam te produceren. Een discussie die we al decennialang niet kunnen beslechten. We kunnen het, zowel in de akkerbouw als in de veeteelt, niet eens worden over wat beter is voor de planeet. Hoewel de intensieve en natuurinclusieve landbouw er ten opzichte van elkaar een volstrekt verschillende aanpak op nahouden, valt voor beide manieren wat te zeggen. Niet alleen in de marketingwereld is het dus onduidelijk wat het betekent om duurzaam te zijn, ook de landbouwwetenschappers komen er niet uit. Het begrip maakt het zo goed als onmogelijk voor boeren om zich op duurzaamheid te onderscheiden, wat problematisch is als je als natuurinclusieve boer een meerprijs moet ontvangen. De keurmerken biologisch en biologisch-dynamisch vormen hierop de uitzondering.

Jouw brein
De tweede oorzaak is de werking van jouw brein. De manier waarop jij beslissingen maakt. Kwaliteit, prijs en gemak zijn de drie centrale voorwaarden. De kwaliteit van het product motiveert de consument om het product te kopen, de juiste prijs is het bedrag dat hij wil en kan betalen en het bieden van gemak verleidt de consument om tot een aankoop te komen. Ieder merk en ieder product heeft met deze marktcondities te maken. Het eigenbelang maakt hierbij de dienst uit. Het is ‘Ego’ vs. ‘Eco’. ‘Ego’ is bij een aankoop altijd aanwezig, een product moet immers altijd allereerst voldoen aan jouw eisen. Vervolgens kan een ‘eco’-aspect een rol spelen. Door de werking van jouw brein gaat dit echter alleen als dit makkelijk te begrijpen is. Denk bijvoorbeeld aan klimaatneutraal, vegetarisch en palmolievrij. De natuurinclusieve landbouw is niet makkelijk te begrijpen en de voordelen zijn volledig ‘eco’. De natuurinclusieve landbouw redt het dus niet in het consumentenbrein.

Het gemak dat verkopers bieden
De derde oorzaak zijn de verkopers van producten, met name supermarkten, maar denk bijvoorbeeld ook aan restaurants, kledingwinkels en tankstations. Deze partijen zijn zeer goed in het voorzien in de wensen van consumenten, waarbij ze op gemak hoog scoren. Ze luisteren naar de behoeftes van de consument, daar zijn ze uiteindelijk van afhankelijk. Duurzaamheid speelt inmiddels mee, waarbij verkopers kiezen voor een zo eenvoudige manier invulling van het begrip duurzaamheid. On-the-way-to-planet-proof is ‘dé duurzamere keuze’, horen we op de radio. Er is in de huidige situatie voor veel verkopers dus geen enkele reden om het aanbod te veranderen. Het aanbod is al duurzaam en de vraag naar biologisch-dynamisch snoep op de sportvereniging zal nog wel even op zich laten wachten. De consument is uiteraard tevreden met de aankoop, wat ook nog eens de duurzamere keuze blijkt te zijn. Hiermee zet de manier waarop verkopers het aanbod samenstellen, de natuurinclusieve landbouw op afstand.

De kracht van merken
De vierde oorzaak is de kracht van merkbeleving. Mensen houden van merken. We herkennen merken al vanaf twee jaar oud. Ze zijn bekend, we weten wat we van ze kunnen verwachten op gebieden als smaak en kwaliteit, maar bijvoorbeeld ook een eenvoudige vorm van duurzaamheid, zoals vegetarisch of plasticvrij. Een manier van landgebruik zal je hier niet aantreffen, de keurmerken biologisch en biologisch-dynamisch vormen hierop de uitzondering.

De macht van prijs
Hoe hoger de prijs, hoe kleiner de vraag. Natuurinclusieve landbouw is per definitie duurder en heeft dus een kleinere markt. Het verkopen van kleine aantallen tegen een hogere prijs, bijvoorbeeld een kilo aardappels, is nog wel te doen, maar hoe groter de volumes, hoe groter het belang van de prijs en hoe moeilijker het is een meerprijs te ontvangen.

Marketing van natuurinclusieve landbouw gaat niet verleiden
In de afgelopen vijftien jaar ben ik een enorme fan van de biologisch-dynamische landbouw en voedselbossen geworden. Ik heb me veelvuldig verwonderd over de fantastische omgeving die zulke natuurinclusieve boeren weten te creëren. Bij een biologisch-dynamische boer kun je lunchen in de koeienstal en in een voedselbos zijn tientallen, zo niet honderden verschillende soorten planten en dieren te vinden. Op elke hectare van deze bedrijven stuit je op een overvloed aan ecosysteemdiensten, zoals schoon water, een rijk bodemleven en opslag van koolstof ter bescherming van het klimaat. Zonder structurele veranderingen zie ik echter niet dat de groep natuurinclusieve boeren groter zal worden.

Zolang we de toekomst van onze aarde overlaten aan de vrije markt en de keuzes bij boeren en consumenten laten, leggen we ons neer bij het gegeven dat Nederland er uitziet zoals het er nu uitziet, waarbij we voor lief nemen dat we meer dan 70% van onze biodiversiteit kwijt zijn

Maar marketing dan? Marketing kan een individuele ondernemer helpen om het bedrijf tot een succes te maken. Ik ben tot de conclusie gekomen dat ook een sterke marketing voor een natuurinclusieve boer dit helaas niet gaat veranderen. De gedachte dat marketing in staat is om in een vrije markt mensen te verleiden tot natuurinclusief consumeren, een gedachte die ik vijf jaar geleden zelf nog had, durf ik inmiddels naïef te noemen. De bovenstaande vijf redenen zijn dusdanig lastig te veranderen, dat ik er inmiddels van overtuigd ben dat we de manier van landgebruik op de wereld niet kunnen veranderen via ondernemers in de vrije markt. Dit kan een individuele ondernemer wel lukken bij een kleine groep consumenten, maar je komt nooit uit die niche. En die niche blijft klein, vanwege deze vijf redenen. Daar heeft de aarde niks aan, daarvoor wil je juist dat de natuurinclusieve landbouw kan opschalen. Ook een uitzonderlijk goede marketing voor de natuurinclusieve landbouw gaat hier geen verandering in aanbrengen. Zolang we de toekomst van onze aarde overlaten aan de vrije markt en de keuzes bij boeren en consumenten laten, leggen we ons neer bij het gegeven dat Nederland er uitziet zoals het er nu uitziet, waarbij we voor lief nemen dat we meer dan 70% van onze biodiversiteit kwijt zijn.

De toekomst van onze aarde
Mochten we in de toekomst graag een biodivers boerenlandschap (terug) zien, dan zullen we onze tijd en energie moeten steken in alternatieven om de natuurinclusieve landbouw een eerlijke kans te geven. Ik zie drie kansrijke routes. Ten eerste stel ik voor om voor ieder product de impact per hectare te gaan meten, naast de impact per product. Hiermee geef je inhoudelijk invulling aan het begrip duurzaamheid en als sector kan je hier direct mee aan de slag. Los van de uitkomsten, zal het in ieder geval zorgen voor een verbetering van de discussie over duurzame landbouw. Laten we er, ten tweede, over nadenken om de financiële verantwoordelijkheid voor het landgebruik, onze omgeving, te verschuiven van boeren naar merken. Merken verdienen een groot deel van de prijs die consumenten betalen voor producten, hebben macht in de keten en een verandering van de prijs voor de gewassen zie je amper terug in het bedrijfsresultaat. In tegenstelling tot de boer, die een klein deel krijgt van de prijzen die consumenten betalen, geen enkele macht in de keten heeft en waarbij een prijsverandering een zeer grote invloed op het inkomen heeft. Tot slot zie ik het waarderen van ecosysteemdiensten én deze verplicht door bedrijven laten afrekenen, nog steeds als kansrijk. Hoewel het waarderen van ecosysteemdiensten complex is, blijft dit een optie die voor een andere toekomst van onze aarde kan zorgen. Er is al een begin gemaakt met CO2.

Zonder ingrijpen zal er nooit sprake zijn van eerlijke concurrentie voor natuurinclusieve ondernemers

Bij al deze drie routes is een ingrijpende overheid onmisbaar. De consument is niet in staat de toekomst van onze aarde te wijzigen; het is onbekend wat duurzaam is, het brein kan slechts simpele dingen meewegen, verkopers en merken hebben geen motivatie om het aanbod te wijzigen ten behoeve van de natuurinclusieve landbouw en dan is er ook altijd nog de hogere kostprijs per product. Zonder ingrijpen zal er nooit sprake zijn van eerlijke concurrentie voor natuurinclusieve ondernemers. De gangbare landbouw zal onze omgeving blijvend vormen. De natuurinclusieve landbouw zal het niet redden zolang de manier van landgebruik niet meetelt in het bedrijfsresultaat. Maar, zoals mijn moeder altijd al zei, ‘waar een wil is, is een weg’. Als de wil er is, is het heel goed mogelijk dat er in de toekomst weer van alles fluit en fladdert in het Nederlandse boerenlandschap. Ik hoop dat de drie genoemde routes daar aan kunnen bijdragen.

Dit artikel is een deel van het boek ‘De oorsprong der producten. De boer, de consument & de toekomst van onze aarde’, dat in april 2022 verschijnt. Wil je graag weten wanneer het boek beschikbaar is? Stuur dan even een mailtje naar erwinvanwoudenberg@gmail.com en je ontvangt een mail zodra het zover is.

We wish to thank the author of this article for this incredible web content

Zonder ingrijpen geen geld op boerenerf – Natuurinclusieve landbouw redt het niet in het consumentenbrein – Foodlog

" } ["summary"]=> string(850) "Iedereen heeft de mond vol van natuurinclusieve landbouw. Maar wat is het eigenlijk? En hoe belangrijk is natuurinclusieve landbouw in relatie tot het grote VN-doel om in 2030 een klimaat neutrale landbouw te realiseren? Is het haalbaar, schaalbaar en betaalbaar? Serie artikelen Vier (oud)-lectoren van HAS Hogeschool, 1 professor van Wageningen University en 1 HAS-alumnus ... Read more" ["atom_content"]=> string(14214) "

Iedereen heeft de mond vol van natuurinclusieve landbouw. Maar wat is het eigenlijk? En hoe belangrijk is natuurinclusieve landbouw in relatie tot het grote VN-doel om in 2030 een klimaat neutrale landbouw te realiseren? Is het haalbaar, schaalbaar en betaalbaar?

Serie artikelen
Vier (oud)-lectoren van HAS Hogeschool, 1 professor van Wageningen University en 1 HAS-alumnus (winnaar HAS Foodmanship award en lid Food100) gaan op zoek naar opiniërende antwoorden in een serie van 6 artikelen. Erwin van Woudenberg, Daan Groot, Harry van Delft, Roger Engelberts, Ruben Burger en Martin Scholten gaan de challenge aan en kijken ieder vanuit hun eigen perspectief naar het vraagstuk. De uitdaging: kan Nederland GIDS-land worden met natuurinclusieve landbouw, waarbij een goed verdienmodel voor de boer centraal staat? Erwin van Woudenberg trapt de serie af.

Boeren zijn de ondernemers in de landbouw. Ondernemers moeten geld verdienen om te kunnen blijven bestaan. De toekomst van onze aarde is voor een groot deel afhankelijk van hoe we de aarde gebruiken. Natuurinclusief boeren is een manier van landgebruik die zorgt voor een toekomstbestendigere aarde. Toch hebben veel natuurinclusieve boeren het financieel lastig. Ze zorgen beter voor onze aarde, hebben daardoor minder productie en dus een hogere kostprijs per product. De natuurinclusieve boer is echter zelf verantwoordelijk voor de noodzakelijk hogere verkoopprijs per product. Dat is een (te) grote opgave. Het aantal natuurinclusieve boeren blijft dan ook laag.

De natuurinclusieve boer is zelf verantwoordelijk voor de noodzakelijk hogere verkoopprijs per product. Dat is een (te) grote opgave

Wat is natuurinclusieve landbouw? Het is lastig natuurinclusieve landbouw precies te definiëren. Ik ga uit van het volgende: ‘Natuurinclusief boeren is als boer op een zo hoog mogelijk niveau voor de omgeving zorgen en, omdat je zo goed voor de natuur zorgt, de potentieel hoogst mogelijke afzet niet kunnen halen, waardoor je te maken hebt met een hogere kostprijs per product’.
Om maar met de deur in huis te vallen: binnen het huidige systeem gaat dit niet veranderen. Ons systeem is gefocust op marktwerking en stimuleert ondernemers daarbij niet in het realiseren van een beter en mooier Nederland, omdat we ecosysteemdiensten in die markt niet waarderen. Dat is niet omdat boeren niet kunnen of niet willen: ik twijfel er niet aan dat boeren in de rij zullen staan als er een financieel goed alternatief is voor de gangbare landbouw. Het is ook niet dat consumenten niet zouden willen, ik ben er van overtuigd dat mensen het liefst geen enkele negatieve impact op de aarde hebben. Toch lukt het niet. Hoe komt dat? Ik benoem hier vijf redenen waarom de vraag van consumenten naar natuurinclusieve landbouw achterblijft en boeren dus (beter) niet kiezen voor de natuurinclusieve landbouw.

Twee waarheden
De eerste reden is het begrip duurzaamheid. Duurzaamheid is een woord dat alles zegt en daarmee niets zegt. Iedereen verstaat er iets anders onder en tegenwoordig noemen we alles duurzaam. Het is niet simpelweg een kwestie van duurzaam tegenover niet-duurzaam; er zijn honderden manieren waarop we duurzaamheid in kunnen vullen. Toch is de term van groot belang voor de consument, omdat de consument zich goed voelt als hij iets koopt met de kwalificatie ‘duurzaam’. De vragen hoe, wat, waar en waarom doen er dan niet meer toe. Dat het product duurzaam is, is toch mooi meegenomen. In werkelijkheid is het op z’n zachtst gezegd onduidelijk wat de consument nu eigenlijk koopt. Het klinkt in den beginne wellicht als een onbelangrijke kwestie, maar in de wereld van marketing kan het belang van het woord ‘duurzaam’ moeilijk worden onderschat. Het betekent dat je, zolang iedereen een beroep kan doen op de kwalificatie ‘duurzaam’, niet kan verwachten dat de markt gaat veranderen.

Niet alleen in de marketingwereld is onduidelijk wat het betekent om duurzaam te zijn, ook de landbouwwetenschappers komen er niet uit

Binnen de landbouw is het nog iets lastiger. In de landbouw is er al tientallen jaren een stevige discussie gaande tussen twee overtuigingen. Aan de ene kant staan de gangbare en intensieve teelten, met hoge grondstofefficiency, aan de andere kant de extensievere en natuurinclusieve teelten. Mooi verwoordt door Charles Mann in zijn boek ‘De tovenaar en de profeet’, claimen beide kanten het meest duurzaam te produceren. Een discussie die we al decennialang niet kunnen beslechten. We kunnen het, zowel in de akkerbouw als in de veeteelt, niet eens worden over wat beter is voor de planeet. Hoewel de intensieve en natuurinclusieve landbouw er ten opzichte van elkaar een volstrekt verschillende aanpak op nahouden, valt voor beide manieren wat te zeggen. Niet alleen in de marketingwereld is het dus onduidelijk wat het betekent om duurzaam te zijn, ook de landbouwwetenschappers komen er niet uit. Het begrip maakt het zo goed als onmogelijk voor boeren om zich op duurzaamheid te onderscheiden, wat problematisch is als je als natuurinclusieve boer een meerprijs moet ontvangen. De keurmerken biologisch en biologisch-dynamisch vormen hierop de uitzondering.

Jouw brein
De tweede oorzaak is de werking van jouw brein. De manier waarop jij beslissingen maakt. Kwaliteit, prijs en gemak zijn de drie centrale voorwaarden. De kwaliteit van het product motiveert de consument om het product te kopen, de juiste prijs is het bedrag dat hij wil en kan betalen en het bieden van gemak verleidt de consument om tot een aankoop te komen. Ieder merk en ieder product heeft met deze marktcondities te maken. Het eigenbelang maakt hierbij de dienst uit. Het is ‘Ego’ vs. ‘Eco’. ‘Ego’ is bij een aankoop altijd aanwezig, een product moet immers altijd allereerst voldoen aan jouw eisen. Vervolgens kan een ‘eco’-aspect een rol spelen. Door de werking van jouw brein gaat dit echter alleen als dit makkelijk te begrijpen is. Denk bijvoorbeeld aan klimaatneutraal, vegetarisch en palmolievrij. De natuurinclusieve landbouw is niet makkelijk te begrijpen en de voordelen zijn volledig ‘eco’. De natuurinclusieve landbouw redt het dus niet in het consumentenbrein.

Het gemak dat verkopers bieden
De derde oorzaak zijn de verkopers van producten, met name supermarkten, maar denk bijvoorbeeld ook aan restaurants, kledingwinkels en tankstations. Deze partijen zijn zeer goed in het voorzien in de wensen van consumenten, waarbij ze op gemak hoog scoren. Ze luisteren naar de behoeftes van de consument, daar zijn ze uiteindelijk van afhankelijk. Duurzaamheid speelt inmiddels mee, waarbij verkopers kiezen voor een zo eenvoudige manier invulling van het begrip duurzaamheid. On-the-way-to-planet-proof is ‘dé duurzamere keuze’, horen we op de radio. Er is in de huidige situatie voor veel verkopers dus geen enkele reden om het aanbod te veranderen. Het aanbod is al duurzaam en de vraag naar biologisch-dynamisch snoep op de sportvereniging zal nog wel even op zich laten wachten. De consument is uiteraard tevreden met de aankoop, wat ook nog eens de duurzamere keuze blijkt te zijn. Hiermee zet de manier waarop verkopers het aanbod samenstellen, de natuurinclusieve landbouw op afstand.

De kracht van merken
De vierde oorzaak is de kracht van merkbeleving. Mensen houden van merken. We herkennen merken al vanaf twee jaar oud. Ze zijn bekend, we weten wat we van ze kunnen verwachten op gebieden als smaak en kwaliteit, maar bijvoorbeeld ook een eenvoudige vorm van duurzaamheid, zoals vegetarisch of plasticvrij. Een manier van landgebruik zal je hier niet aantreffen, de keurmerken biologisch en biologisch-dynamisch vormen hierop de uitzondering.

De macht van prijs
Hoe hoger de prijs, hoe kleiner de vraag. Natuurinclusieve landbouw is per definitie duurder en heeft dus een kleinere markt. Het verkopen van kleine aantallen tegen een hogere prijs, bijvoorbeeld een kilo aardappels, is nog wel te doen, maar hoe groter de volumes, hoe groter het belang van de prijs en hoe moeilijker het is een meerprijs te ontvangen.

Marketing van natuurinclusieve landbouw gaat niet verleiden
In de afgelopen vijftien jaar ben ik een enorme fan van de biologisch-dynamische landbouw en voedselbossen geworden. Ik heb me veelvuldig verwonderd over de fantastische omgeving die zulke natuurinclusieve boeren weten te creëren. Bij een biologisch-dynamische boer kun je lunchen in de koeienstal en in een voedselbos zijn tientallen, zo niet honderden verschillende soorten planten en dieren te vinden. Op elke hectare van deze bedrijven stuit je op een overvloed aan ecosysteemdiensten, zoals schoon water, een rijk bodemleven en opslag van koolstof ter bescherming van het klimaat. Zonder structurele veranderingen zie ik echter niet dat de groep natuurinclusieve boeren groter zal worden.

Zolang we de toekomst van onze aarde overlaten aan de vrije markt en de keuzes bij boeren en consumenten laten, leggen we ons neer bij het gegeven dat Nederland er uitziet zoals het er nu uitziet, waarbij we voor lief nemen dat we meer dan 70% van onze biodiversiteit kwijt zijn

Maar marketing dan? Marketing kan een individuele ondernemer helpen om het bedrijf tot een succes te maken. Ik ben tot de conclusie gekomen dat ook een sterke marketing voor een natuurinclusieve boer dit helaas niet gaat veranderen. De gedachte dat marketing in staat is om in een vrije markt mensen te verleiden tot natuurinclusief consumeren, een gedachte die ik vijf jaar geleden zelf nog had, durf ik inmiddels naïef te noemen. De bovenstaande vijf redenen zijn dusdanig lastig te veranderen, dat ik er inmiddels van overtuigd ben dat we de manier van landgebruik op de wereld niet kunnen veranderen via ondernemers in de vrije markt. Dit kan een individuele ondernemer wel lukken bij een kleine groep consumenten, maar je komt nooit uit die niche. En die niche blijft klein, vanwege deze vijf redenen. Daar heeft de aarde niks aan, daarvoor wil je juist dat de natuurinclusieve landbouw kan opschalen. Ook een uitzonderlijk goede marketing voor de natuurinclusieve landbouw gaat hier geen verandering in aanbrengen. Zolang we de toekomst van onze aarde overlaten aan de vrije markt en de keuzes bij boeren en consumenten laten, leggen we ons neer bij het gegeven dat Nederland er uitziet zoals het er nu uitziet, waarbij we voor lief nemen dat we meer dan 70% van onze biodiversiteit kwijt zijn.

De toekomst van onze aarde
Mochten we in de toekomst graag een biodivers boerenlandschap (terug) zien, dan zullen we onze tijd en energie moeten steken in alternatieven om de natuurinclusieve landbouw een eerlijke kans te geven. Ik zie drie kansrijke routes. Ten eerste stel ik voor om voor ieder product de impact per hectare te gaan meten, naast de impact per product. Hiermee geef je inhoudelijk invulling aan het begrip duurzaamheid en als sector kan je hier direct mee aan de slag. Los van de uitkomsten, zal het in ieder geval zorgen voor een verbetering van de discussie over duurzame landbouw. Laten we er, ten tweede, over nadenken om de financiële verantwoordelijkheid voor het landgebruik, onze omgeving, te verschuiven van boeren naar merken. Merken verdienen een groot deel van de prijs die consumenten betalen voor producten, hebben macht in de keten en een verandering van de prijs voor de gewassen zie je amper terug in het bedrijfsresultaat. In tegenstelling tot de boer, die een klein deel krijgt van de prijzen die consumenten betalen, geen enkele macht in de keten heeft en waarbij een prijsverandering een zeer grote invloed op het inkomen heeft. Tot slot zie ik het waarderen van ecosysteemdiensten én deze verplicht door bedrijven laten afrekenen, nog steeds als kansrijk. Hoewel het waarderen van ecosysteemdiensten complex is, blijft dit een optie die voor een andere toekomst van onze aarde kan zorgen. Er is al een begin gemaakt met CO2.

Zonder ingrijpen zal er nooit sprake zijn van eerlijke concurrentie voor natuurinclusieve ondernemers

Bij al deze drie routes is een ingrijpende overheid onmisbaar. De consument is niet in staat de toekomst van onze aarde te wijzigen; het is onbekend wat duurzaam is, het brein kan slechts simpele dingen meewegen, verkopers en merken hebben geen motivatie om het aanbod te wijzigen ten behoeve van de natuurinclusieve landbouw en dan is er ook altijd nog de hogere kostprijs per product. Zonder ingrijpen zal er nooit sprake zijn van eerlijke concurrentie voor natuurinclusieve ondernemers. De gangbare landbouw zal onze omgeving blijvend vormen. De natuurinclusieve landbouw zal het niet redden zolang de manier van landgebruik niet meetelt in het bedrijfsresultaat. Maar, zoals mijn moeder altijd al zei, ‘waar een wil is, is een weg’. Als de wil er is, is het heel goed mogelijk dat er in de toekomst weer van alles fluit en fladdert in het Nederlandse boerenlandschap. Ik hoop dat de drie genoemde routes daar aan kunnen bijdragen.

Dit artikel is een deel van het boek ‘De oorsprong der producten. De boer, de consument & de toekomst van onze aarde’, dat in april 2022 verschijnt. Wil je graag weten wanneer het boek beschikbaar is? Stuur dan even een mailtje naar erwinvanwoudenberg@gmail.com en je ontvangt een mail zodra het zover is.

We wish to thank the author of this article for this incredible web content

Zonder ingrijpen geen geld op boerenerf – Natuurinclusieve landbouw redt het niet in het consumentenbrein – Foodlog

" ["date_timestamp"]=> int(1643266913) } [3]=> array(11) { ["title"]=> string(41) "Ancient Maya lessons on surviving drought" ["link"]=> string(74) "https://firstmediamarketing.com/ancient-maya-lessons-on-surviving-drought/" ["dc"]=> array(1) { ["creator"]=> string(12) "Tony Grantly" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 06:06:31 +0000" ["category"]=> string(52) "Health And ScienceancientdroughtlessonsMayaSurviving" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10060" ["description"]=> string(612) "Journal Reference: Scott L. Fedick, Louis S. Santiago. Large variation in availability of Maya food plant sources during ancient droughts. Proceedings of the National Academy of Sciences, 2021; 119 (1): e2115657118 DOI: 10.1073/pnas.2115657118 There is no dispute that a series of droughts occurred in the Yucatan Peninsula of southeastern Mexico and northern Central America at ... Read more" ["content"]=> array(1) { ["encoded"]=> string(3480) "

Journal Reference:

  1. Scott L. Fedick, Louis S. Santiago. Large variation in availability of Maya food plant sources during ancient droughts. Proceedings of the National Academy of Sciences, 2021; 119 (1): e2115657118 DOI: 10.1073/pnas.2115657118

There is no dispute that a series of droughts occurred in the Yucatan Peninsula of southeastern Mexico and northern Central America at the end of the ninth century, when Maya cities mysteriously began to be depopulated. Believing the Maya were mostly dependent on drought-sensitive corn, beans, and squash, some scholars assume the droughts resulted in starvation.

However, a new analysis by UC Riverside archaeologist Scott Fedick and plant physiologist Louis Santiago shows the Maya had nearly 500 edible plants available to them, many of which are highly drought resistant. The results of this analysis have now been published in the Proceedings of the National Academy of Sciences.

“Even in the most extreme drought situation — and we have no clear evidence the most extreme situation ever occurred — 59 species of edible plants would still have persisted,” Santiago said.

Some of the toughest plants the Maya would have turned to include cassava with its edible tubers, and hearts of palm. Another is chaya, a shrub domesticated by the Maya and eaten today by their descendants. Its leaves are high in protein, iron, potassium, and calcium.

“Chaya and cassava together would have provided a huge amount of carbohydrates and protein,” Santiago said.

Unable to find a master list of indigenous Maya food plants, Fedick recently compiled and published one that draws on decades of Maya plant knowledge. Faced with much speculation about drought as the cause of Maya social disruptions, he and Santiago decided to examine all 497 plants on the list for drought tolerance.

“When botanists study drought resistance, they’re usually talking about a specific plant, or a particular ecosystem,” Fedick said. “One of the reasons this project was so challenging is because we examined the dietary flora of an entire civilization — annuals, perennials, herbs, trees, domesticates, and wild species. It was a unique endeavor.”

Though the researchers do not have a clear answer about why ancient Maya society unraveled, they suspect social and economic upheaval played a role.

“One thing we do know is the overly simplistic explanation of drought leading to agricultural collapse is probably not true,” Fedick said.

The research also demonstrates the importance of exploiting a variety of plants to survive drought and climate change.

“Even given a series of droughts, maintaining a diversity of resilient crops would enable people, both ancient and modern, to adapt and survive,” Santiago said.

We want to thank the writer of this article for this amazing material

Ancient Maya lessons on surviving drought

" } ["summary"]=> string(612) "Journal Reference: Scott L. Fedick, Louis S. Santiago. Large variation in availability of Maya food plant sources during ancient droughts. Proceedings of the National Academy of Sciences, 2021; 119 (1): e2115657118 DOI: 10.1073/pnas.2115657118 There is no dispute that a series of droughts occurred in the Yucatan Peninsula of southeastern Mexico and northern Central America at ... Read more" ["atom_content"]=> string(3480) "

Journal Reference:

  1. Scott L. Fedick, Louis S. Santiago. Large variation in availability of Maya food plant sources during ancient droughts. Proceedings of the National Academy of Sciences, 2021; 119 (1): e2115657118 DOI: 10.1073/pnas.2115657118

There is no dispute that a series of droughts occurred in the Yucatan Peninsula of southeastern Mexico and northern Central America at the end of the ninth century, when Maya cities mysteriously began to be depopulated. Believing the Maya were mostly dependent on drought-sensitive corn, beans, and squash, some scholars assume the droughts resulted in starvation.

However, a new analysis by UC Riverside archaeologist Scott Fedick and plant physiologist Louis Santiago shows the Maya had nearly 500 edible plants available to them, many of which are highly drought resistant. The results of this analysis have now been published in the Proceedings of the National Academy of Sciences.

“Even in the most extreme drought situation — and we have no clear evidence the most extreme situation ever occurred — 59 species of edible plants would still have persisted,” Santiago said.

Some of the toughest plants the Maya would have turned to include cassava with its edible tubers, and hearts of palm. Another is chaya, a shrub domesticated by the Maya and eaten today by their descendants. Its leaves are high in protein, iron, potassium, and calcium.

“Chaya and cassava together would have provided a huge amount of carbohydrates and protein,” Santiago said.

Unable to find a master list of indigenous Maya food plants, Fedick recently compiled and published one that draws on decades of Maya plant knowledge. Faced with much speculation about drought as the cause of Maya social disruptions, he and Santiago decided to examine all 497 plants on the list for drought tolerance.

“When botanists study drought resistance, they’re usually talking about a specific plant, or a particular ecosystem,” Fedick said. “One of the reasons this project was so challenging is because we examined the dietary flora of an entire civilization — annuals, perennials, herbs, trees, domesticates, and wild species. It was a unique endeavor.”

Though the researchers do not have a clear answer about why ancient Maya society unraveled, they suspect social and economic upheaval played a role.

“One thing we do know is the overly simplistic explanation of drought leading to agricultural collapse is probably not true,” Fedick said.

The research also demonstrates the importance of exploiting a variety of plants to survive drought and climate change.

“Even given a series of droughts, maintaining a diversity of resilient crops would enable people, both ancient and modern, to adapt and survive,” Santiago said.

We want to thank the writer of this article for this amazing material

Ancient Maya lessons on surviving drought

" ["date_timestamp"]=> int(1643263591) } [4]=> array(11) { ["title"]=> string(163) "‘Supermarktpersoneel hoeft straks niet meer in quarantaine’ – Vakkenvullers, kassamedewerkers en vrachtwagenchauffeurs – iedereen is essentieel – Foodlog" ["link"]=> string(177) "https://firstmediamarketing.com/supermarktpersoneel-hoeft-straks-niet-meer-in-quarantaine-vakkenvullers-kassamedewerkers-en-vrachtwagenchauffeurs-iedereen-is-essentieel-foodlog/" ["dc"]=> array(1) { ["creator"]=> string(12) "Paula Hooper" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 05:49:23 +0000" ["category"]=> string(133) "LifestyleessentieelFoodloghoeftiedereenkassamedewerkersmeernietquarantainestraksSupermarktpersoneelVakkenvullersvrachtwagenchauffeurs" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10055" ["description"]=> string(1002) "De cijfers uit België liegen er niet om. Een ziekteverzuim van gemiddeld ruim 8%, en daardoor een productiedaling van 8%. “Twee op de drie voedingsbedrijven kampt met minstens 5 procent personeelsuitval. Gemiddeld gaat het om 8,4 procent van de werknemers die zich dezer dagen ziek meldt wegens corona,” zei Nicholas Courant, directeur communicatie van sectorfederatie ... Read more" ["content"]=> array(1) { ["encoded"]=> string(6087) "

De cijfers uit België liegen er niet om. Een ziekteverzuim van gemiddeld ruim 8%, en daardoor een productiedaling van 8%. “Twee op de drie voedingsbedrijven kampt met minstens 5 procent personeelsuitval. Gemiddeld gaat het om 8,4 procent van de werknemers die zich dezer dagen ziek meldt wegens corona,” zei Nicholas Courant, directeur communicatie van sectorfederatie Fevia (de Belgische pendant van de Federatie Nederlandse Levensmiddelen Industrie). Niet alleen omdat ze zelf ziek zien, maar ook omdat ze in quarantaine moeten door een besmetting in de directe omgeving.

We gaan echt zien dat de schappen leeg beginnen te raken

Roosterprobleem
In Nederland trok supermarktkoepel CBL aan de bel. “Er zijn steeds grotere roosterproblemen bij supermarkten door de uitval van personeel dat in quarantaine moet,” zei CBL-directeur Marc Jansen in diverse media. “We gaan echt zien dat de schappen leeg beginnen te raken.”

De noodkreet van het CBL bleek ingegeven doordat het kabinet zich niet wilde wagen aan het definiëren van ‘cruciale beroepen’ en de hete aardappel doorschoof naar de bedrijven zelf. Het ministerie van Sociale Zaken wilde dat werkgevers en werknemers zelf uitvogelen wat de cruciale functies waren om Nederland niet plat te leggen als omikron steeds meer mensen zou besmetten. Maar die gesprekken verliepen uiterst stroef, omdat de vakbonden het niet zagen zitten dat werkgevers zouden mogen bepalen wat cruciale functies waren. “Dat zet de deur open voor minder scrupuleuze werkgevers in bijvoorbeeld de retail om al hun magazijnpersoneel cruciaal te verklaren,” zei Kitty Jong van de FNV in het Financieele Dagblad. Ze wees ook slachterijen, verpleeghuizen, thuiszorg en winkels aan als ‘probleemsectoren’ wat betreft veiligheid.

Het ging allemaal zo moeilijk dat Jansen een oproep via de media deed aan het kabinet om de quarantainemaatregelen te versoepelen voor de hele supermarktsector. Die wordt nog eens extra getroffen doordat er veel 18-minners werken, die nog niet eens een boosterprik mogen halen. Het kabinet bleek uiteindelijk weinig oor te hebben voor de noden van de supermarkten. Tijdens de persconferentie werd er geen algehele versoepeling van de quarantaineregels afgekondigd. Alleen de 18-minners hoefden niet meer in quarantaine, maar dat was om naar school te kunnen, niet naar hun bijbaan als vakkenvuller of caissière.

In de vleessector schommelt het ziekteverzuim tussen de 5 à 10%, al zijn er ook bedrijven waar het uitvalspercentage boven de 10% uitkomt

‘Essentiële bedrijfsprocessen’
Wel was daar ineens de ‘uitzondering quarantaine voor werknemers in essentiële bedrijfsprocessen’. Volgens die uitzondering hoeven werknemers die essentieel zijn voor de continuïteit van de organisatie, die niet vervangen kunnen worden en niet vanuit huis kunnen werken, niet in quarantaine. Onder voorwaarden: “De werkgever overlegt met de ondernemingsraad, personeelsvertegenwoordiging of personeelsvergadering over welke functies essentieel zijn. De werkgever heeft instemming nodig van de ondernemingsraad of de personeelsvertegenwoordiging. Of vraagt de personeelsvergadering om advies.”

‘Risicoafweging binnen het bedrijf’
Met die nieuwe regels is vleeskoepel COV wel tevreden. In de vleessector schommelt het ziekteverzuim tussen de 5 à 10%, al zijn er ook bedrijven waar het uitvalspercentage boven de 10% uitkomt, zegt algemeen secretaris Richard van de Kruijk desgevraagd. Het is dus van belang om heel kritisch te kijken naar wat mogelijk is aan versoepelingen en tegelijk de werknemers zo gezond en veilig mogelijk te laten werken. Leg de versoepelingen dus bij de bedrijven, bepleitte het COV, die kunnen zelf het beste de risicoafweging maken. En dat is precies wat het kabinet nu heeft gedaan. Bedrijven moeten zelf in overleg met de ondernemingsraden benoemen wat de cruciale bedrijfsprocessen zijn en of er voldoende waarborgen zijn om het personeel gezond te houden. Daar is de sector inmiddels heel vertrouwd mee; al die risicoanalyses zijn de afgelopen 2 jaar gemaakt.

Marc Jansen reageert met gemengde gevoelens. Hij had liever gezien dat de hele voedingssector als cruciaal zou worden vrijgesteld van de quarantaineregels. Nu ontstaat er administratieve rompslomp omdat iedereen met elkaar om de tafel moet om te bepalen wat de cruciale functies zijn en hoe de risicoprofielen eruit zien. Terwijl het zo simpel had kunnen zijn: “iedere persoon die ingeroosterd wordt, heeft een cruciale functie.” Of het nu de orderpicker in het distributiecentrum, de vrachtwagenchauffeur of de caissière is, “je zult zien, dan hoeft eigenlijk niemand meer in quarantaine” denkt Jansen.

We want to say thanks to the writer of this article for this awesome material

‘Supermarktpersoneel hoeft straks niet meer in quarantaine’ – Vakkenvullers, kassamedewerkers en vrachtwagenchauffeurs – iedereen is essentieel – Foodlog

" } ["summary"]=> string(1002) "De cijfers uit België liegen er niet om. Een ziekteverzuim van gemiddeld ruim 8%, en daardoor een productiedaling van 8%. “Twee op de drie voedingsbedrijven kampt met minstens 5 procent personeelsuitval. Gemiddeld gaat het om 8,4 procent van de werknemers die zich dezer dagen ziek meldt wegens corona,” zei Nicholas Courant, directeur communicatie van sectorfederatie ... Read more" ["atom_content"]=> string(6087) "

De cijfers uit België liegen er niet om. Een ziekteverzuim van gemiddeld ruim 8%, en daardoor een productiedaling van 8%. “Twee op de drie voedingsbedrijven kampt met minstens 5 procent personeelsuitval. Gemiddeld gaat het om 8,4 procent van de werknemers die zich dezer dagen ziek meldt wegens corona,” zei Nicholas Courant, directeur communicatie van sectorfederatie Fevia (de Belgische pendant van de Federatie Nederlandse Levensmiddelen Industrie). Niet alleen omdat ze zelf ziek zien, maar ook omdat ze in quarantaine moeten door een besmetting in de directe omgeving.

We gaan echt zien dat de schappen leeg beginnen te raken

Roosterprobleem
In Nederland trok supermarktkoepel CBL aan de bel. “Er zijn steeds grotere roosterproblemen bij supermarkten door de uitval van personeel dat in quarantaine moet,” zei CBL-directeur Marc Jansen in diverse media. “We gaan echt zien dat de schappen leeg beginnen te raken.”

De noodkreet van het CBL bleek ingegeven doordat het kabinet zich niet wilde wagen aan het definiëren van ‘cruciale beroepen’ en de hete aardappel doorschoof naar de bedrijven zelf. Het ministerie van Sociale Zaken wilde dat werkgevers en werknemers zelf uitvogelen wat de cruciale functies waren om Nederland niet plat te leggen als omikron steeds meer mensen zou besmetten. Maar die gesprekken verliepen uiterst stroef, omdat de vakbonden het niet zagen zitten dat werkgevers zouden mogen bepalen wat cruciale functies waren. “Dat zet de deur open voor minder scrupuleuze werkgevers in bijvoorbeeld de retail om al hun magazijnpersoneel cruciaal te verklaren,” zei Kitty Jong van de FNV in het Financieele Dagblad. Ze wees ook slachterijen, verpleeghuizen, thuiszorg en winkels aan als ‘probleemsectoren’ wat betreft veiligheid.

Het ging allemaal zo moeilijk dat Jansen een oproep via de media deed aan het kabinet om de quarantainemaatregelen te versoepelen voor de hele supermarktsector. Die wordt nog eens extra getroffen doordat er veel 18-minners werken, die nog niet eens een boosterprik mogen halen. Het kabinet bleek uiteindelijk weinig oor te hebben voor de noden van de supermarkten. Tijdens de persconferentie werd er geen algehele versoepeling van de quarantaineregels afgekondigd. Alleen de 18-minners hoefden niet meer in quarantaine, maar dat was om naar school te kunnen, niet naar hun bijbaan als vakkenvuller of caissière.

In de vleessector schommelt het ziekteverzuim tussen de 5 à 10%, al zijn er ook bedrijven waar het uitvalspercentage boven de 10% uitkomt

‘Essentiële bedrijfsprocessen’
Wel was daar ineens de ‘uitzondering quarantaine voor werknemers in essentiële bedrijfsprocessen’. Volgens die uitzondering hoeven werknemers die essentieel zijn voor de continuïteit van de organisatie, die niet vervangen kunnen worden en niet vanuit huis kunnen werken, niet in quarantaine. Onder voorwaarden: “De werkgever overlegt met de ondernemingsraad, personeelsvertegenwoordiging of personeelsvergadering over welke functies essentieel zijn. De werkgever heeft instemming nodig van de ondernemingsraad of de personeelsvertegenwoordiging. Of vraagt de personeelsvergadering om advies.”

‘Risicoafweging binnen het bedrijf’
Met die nieuwe regels is vleeskoepel COV wel tevreden. In de vleessector schommelt het ziekteverzuim tussen de 5 à 10%, al zijn er ook bedrijven waar het uitvalspercentage boven de 10% uitkomt, zegt algemeen secretaris Richard van de Kruijk desgevraagd. Het is dus van belang om heel kritisch te kijken naar wat mogelijk is aan versoepelingen en tegelijk de werknemers zo gezond en veilig mogelijk te laten werken. Leg de versoepelingen dus bij de bedrijven, bepleitte het COV, die kunnen zelf het beste de risicoafweging maken. En dat is precies wat het kabinet nu heeft gedaan. Bedrijven moeten zelf in overleg met de ondernemingsraden benoemen wat de cruciale bedrijfsprocessen zijn en of er voldoende waarborgen zijn om het personeel gezond te houden. Daar is de sector inmiddels heel vertrouwd mee; al die risicoanalyses zijn de afgelopen 2 jaar gemaakt.

Marc Jansen reageert met gemengde gevoelens. Hij had liever gezien dat de hele voedingssector als cruciaal zou worden vrijgesteld van de quarantaineregels. Nu ontstaat er administratieve rompslomp omdat iedereen met elkaar om de tafel moet om te bepalen wat de cruciale functies zijn en hoe de risicoprofielen eruit zien. Terwijl het zo simpel had kunnen zijn: “iedere persoon die ingeroosterd wordt, heeft een cruciale functie.” Of het nu de orderpicker in het distributiecentrum, de vrachtwagenchauffeur of de caissière is, “je zult zien, dan hoeft eigenlijk niemand meer in quarantaine” denkt Jansen.

We want to say thanks to the writer of this article for this awesome material

‘Supermarktpersoneel hoeft straks niet meer in quarantaine’ – Vakkenvullers, kassamedewerkers en vrachtwagenchauffeurs – iedereen is essentieel – Foodlog

" ["date_timestamp"]=> int(1643262563) } [5]=> array(11) { ["title"]=> string(97) "6 Momen Arsy Pamer Hasil Rapor Sekolah, Ashanty Syok Lihat Nilai Matematika : Okezone Celebrity" ["link"]=> string(125) "https://firstmediamarketing.com/6-momen-arsy-pamer-hasil-rapor-sekolah-ashanty-syok-lihat-nilai-matematika-okezone-celebrity/" ["dc"]=> array(1) { ["creator"]=> string(12) "Sally Scully" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 05:39:54 +0000" ["category"]=> string(83) "ShowsArsyAshantyCelebrityHasilLihatMatematikaMomenNilaiOkezonePamerRaporSekolahSyok" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10051" ["description"]=> string(784) "ARSY Hermansyah belum lama ini menunjukkan hasil rapor kepada Ashanty. Istri Anang Hermansyah itu langsung terkejut melihat nilai dan prestasi anak ketiganya itu.  Salah satu yang menjadi sorotan adalah nilai matematika Arsy. Penasaran dengan momen Arsy terima rapor? Simak ulasannya berikut ini, dikutip dari kanal YouTube The Hermansyah A6, Rabu (26/1/2022). 1. ... Read more" ["content"]=> array(1) { ["encoded"]=> string(5683) "

ARSY Hermansyah belum lama ini menunjukkan hasil rapor kepada Ashanty. Istri Anang Hermansyah itu langsung terkejut melihat nilai dan prestasi anak ketiganya itu. 

Salah satu yang menjadi sorotan adalah nilai matematika Arsy. Penasaran dengan momen Arsy terima rapor? Simak ulasannya berikut ini, dikutip dari kanal YouTube The Hermansyah A6, Rabu (26/1/2022).


1. Momen Arsy memperlihatkan nilai rapor ke Ashanty  

Arsy Hermansyah yang masih memakai seragam pramuka langsung mengambil tote bag berwarna merah untuk memamerkan nilai rapornya kepada Ashanty. Dia tampak dengan senang hati menunjukkan semua nilai dan prestasinya. Ini bisa dilihat dari ekspresi wajahnya. Bocah 7 tahun itu tak henti-hentinya tersenyum ke kamera.

2. Ashanty kaget dengan nilai matematika Arsy

rapor arsy

Tak menunggu waktu lama, Ashanty lantas membuka rapor putrinya itu. Setelah melihat singkat seluruh nilai sang anak, dia langsung terkejut dengan nilai matematika Arsy. Pasalnya, putrinya itu mendapat nilai terendah dibandingkan pelajaran lainnya, yakni 85. Sembari bertanya alasan dibalik nilai tersebut, Ashanty tak lupa mengungkapkan rasa bangganya. Dia pun berpesan kepada putrinya agar semakin giat belajar matematika.

“Matematikanya kenapa 85, nggak apa sih, belajar lagi ya. That’s good. Fokus lagi karena di sini kakak yang lumayan harus belajar lagi matematika ya,” ucap Ashanty.

3. Nilai rata-rata 90 

Meski nilai matematika Arsy masih harus diperbaiki menurut sang bunda, namun nilai-nilai pelajaran lainnya cukup memuaskan. Ini terpampang jelas di kamera. Semua nilai Arsy di atas 80, baik dalam mata pelajaran akademik maupun pelajaran kreativitas seperti seni budaya, olahraga dan bahasa Inggris. Bahkan total nilai rata-ratanya mencapai 90. So proud!

4. Foto imut Arsy 

arsy

Foto profil Arsy rupanya berhasil mencuri perhatian. Bocah kelahiran 14 Desember 2014 itu terlihat sangat imut dengan poni pendek di atas alis. Senyumnya pun terlihat menggemaskan. Ashanty sempat menyinggung potret itu kepada sang anak. Arsy langsung tersipu malu saat digoda sang ibunda.

“Ini siapa ponian nih?” kata Ashanty.

“Jangan gitu dong,” sahut Arsy.

5. Perkembangan sosial dan perilaku Arsy baik semua 

arsy

Tak hanya nilai pelajaran yang bagus, perkembangan sosial dan perilaku Arsy pun mendapat nilai yang memuaskan. Putri Ashanty ini rupanya cukup dikenal sebagai murid yang baik selama menjalani pembelajaran di sekolah. Hebat banget, ya.

6. Arsy menyukai pelajaran science 

Arsy Hermansyah mengaku sangat menyukai science atau pelajaran IPA. Pantas saja pada pelajaran tersebut Arsy berhasil mencapai nilai 91. Kepada Ashanty, Arsy bercerita bahwa dirinya sangat ingin membuat roket dari kardus. Pasalnya, dia ingin memperlihatkan hasil karyanya itu kepada banyak orang. Melihat pencapaian rapor yang memuaskan ini, Ashanty berjanji akan memberikan hadiah spesial untuk sang anak. Wah, seru banget ya.

We would love to give thanks to the writer of this short article for this awesome material

6 Momen Arsy Pamer Hasil Rapor Sekolah, Ashanty Syok Lihat Nilai Matematika : Okezone Celebrity

" } ["summary"]=> string(784) "ARSY Hermansyah belum lama ini menunjukkan hasil rapor kepada Ashanty. Istri Anang Hermansyah itu langsung terkejut melihat nilai dan prestasi anak ketiganya itu.  Salah satu yang menjadi sorotan adalah nilai matematika Arsy. Penasaran dengan momen Arsy terima rapor? Simak ulasannya berikut ini, dikutip dari kanal YouTube The Hermansyah A6, Rabu (26/1/2022). 1. ... Read more" ["atom_content"]=> string(5683) "

ARSY Hermansyah belum lama ini menunjukkan hasil rapor kepada Ashanty. Istri Anang Hermansyah itu langsung terkejut melihat nilai dan prestasi anak ketiganya itu. 

Salah satu yang menjadi sorotan adalah nilai matematika Arsy. Penasaran dengan momen Arsy terima rapor? Simak ulasannya berikut ini, dikutip dari kanal YouTube The Hermansyah A6, Rabu (26/1/2022).


1. Momen Arsy memperlihatkan nilai rapor ke Ashanty  

Arsy Hermansyah yang masih memakai seragam pramuka langsung mengambil tote bag berwarna merah untuk memamerkan nilai rapornya kepada Ashanty. Dia tampak dengan senang hati menunjukkan semua nilai dan prestasinya. Ini bisa dilihat dari ekspresi wajahnya. Bocah 7 tahun itu tak henti-hentinya tersenyum ke kamera.

2. Ashanty kaget dengan nilai matematika Arsy

rapor arsy

Tak menunggu waktu lama, Ashanty lantas membuka rapor putrinya itu. Setelah melihat singkat seluruh nilai sang anak, dia langsung terkejut dengan nilai matematika Arsy. Pasalnya, putrinya itu mendapat nilai terendah dibandingkan pelajaran lainnya, yakni 85. Sembari bertanya alasan dibalik nilai tersebut, Ashanty tak lupa mengungkapkan rasa bangganya. Dia pun berpesan kepada putrinya agar semakin giat belajar matematika.

“Matematikanya kenapa 85, nggak apa sih, belajar lagi ya. That’s good. Fokus lagi karena di sini kakak yang lumayan harus belajar lagi matematika ya,” ucap Ashanty.

3. Nilai rata-rata 90 

Meski nilai matematika Arsy masih harus diperbaiki menurut sang bunda, namun nilai-nilai pelajaran lainnya cukup memuaskan. Ini terpampang jelas di kamera. Semua nilai Arsy di atas 80, baik dalam mata pelajaran akademik maupun pelajaran kreativitas seperti seni budaya, olahraga dan bahasa Inggris. Bahkan total nilai rata-ratanya mencapai 90. So proud!

4. Foto imut Arsy 

arsy

Foto profil Arsy rupanya berhasil mencuri perhatian. Bocah kelahiran 14 Desember 2014 itu terlihat sangat imut dengan poni pendek di atas alis. Senyumnya pun terlihat menggemaskan. Ashanty sempat menyinggung potret itu kepada sang anak. Arsy langsung tersipu malu saat digoda sang ibunda.

“Ini siapa ponian nih?” kata Ashanty.

“Jangan gitu dong,” sahut Arsy.

5. Perkembangan sosial dan perilaku Arsy baik semua 

arsy

Tak hanya nilai pelajaran yang bagus, perkembangan sosial dan perilaku Arsy pun mendapat nilai yang memuaskan. Putri Ashanty ini rupanya cukup dikenal sebagai murid yang baik selama menjalani pembelajaran di sekolah. Hebat banget, ya.

6. Arsy menyukai pelajaran science 

Arsy Hermansyah mengaku sangat menyukai science atau pelajaran IPA. Pantas saja pada pelajaran tersebut Arsy berhasil mencapai nilai 91. Kepada Ashanty, Arsy bercerita bahwa dirinya sangat ingin membuat roket dari kardus. Pasalnya, dia ingin memperlihatkan hasil karyanya itu kepada banyak orang. Melihat pencapaian rapor yang memuaskan ini, Ashanty berjanji akan memberikan hadiah spesial untuk sang anak. Wah, seru banget ya.

We would love to give thanks to the writer of this short article for this awesome material

6 Momen Arsy Pamer Hasil Rapor Sekolah, Ashanty Syok Lihat Nilai Matematika : Okezone Celebrity

" ["date_timestamp"]=> int(1643261994) } [6]=> array(11) { ["title"]=> string(67) "Eurimages backs projects from Mia Hansen-Løve, ‘Rams’ director" ["link"]=> string(92) "https://firstmediamarketing.com/eurimages-backs-projects-from-mia-hansen-love-rams-director/" ["dc"]=> array(1) { ["creator"]=> string(12) "Sally Scully" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 05:19:50 +0000" ["category"]=> string(69) "Movie Production CompaniesdirectorEurimagesHansenLøveMiaProjectsRams" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10045" ["description"]=> string(662) "Following its 150th meeting in Yerevan, Armenia from March 13-16, European cinema body Eurimages has awarded funding to 20 film projects. Of the supported titles, 17 are fiction, two are animated and one is a documentary. 30% of those receiving support have female directors, who cumulatively receive 34% of the total money awarded. See below ... Read more" ["content"]=> array(1) { ["encoded"]=> string(4570) "

Following its 150th meeting in Yerevan, Armenia from March 13-16, European cinema body Eurimages has awarded funding to 20 film projects.

Of the supported titles, 17 are fiction, two are animated and one is a documentary. 30% of those receiving support have female directors, who cumulatively receive 34% of the total money awarded.

See below for the full list of projects

Among the projects are Bergman Island, the next film from French director Mia Hansen-Løve (Things To Come). Launched at Cannes last year, the story centres on an American filmmaking couple who find the line between reality and fiction blurred when writing screenplays on Faro, the island that was home to Ingmar Bergman. It is set to star Greta Gerwig, Mia Wasikowska and John Turturro.

Also awarded funding is Grimur Hakonarson’s The County, a drama set in rural Iceland about a widowed middle-aged cow farmer. As with Hakonarson’s Un Certain Regard-winning Rams, New Europe is handling sales on the project.

Separately, through the Distribution Support Programme, Eurimages is backing 18 requests from 13 distributors, totalling €171,675, with titles coming from Switzerland, Russia, Turkey and Canada.

Eurimages film projects

We would love to thank the author of this article for this incredible content

Eurimages backs projects from Mia Hansen-Løve, ‘Rams’ director

" } ["summary"]=> string(662) "Following its 150th meeting in Yerevan, Armenia from March 13-16, European cinema body Eurimages has awarded funding to 20 film projects. Of the supported titles, 17 are fiction, two are animated and one is a documentary. 30% of those receiving support have female directors, who cumulatively receive 34% of the total money awarded. See below ... Read more" ["atom_content"]=> string(4570) "

Following its 150th meeting in Yerevan, Armenia from March 13-16, European cinema body Eurimages has awarded funding to 20 film projects.

Of the supported titles, 17 are fiction, two are animated and one is a documentary. 30% of those receiving support have female directors, who cumulatively receive 34% of the total money awarded.

See below for the full list of projects

Among the projects are Bergman Island, the next film from French director Mia Hansen-Løve (Things To Come). Launched at Cannes last year, the story centres on an American filmmaking couple who find the line between reality and fiction blurred when writing screenplays on Faro, the island that was home to Ingmar Bergman. It is set to star Greta Gerwig, Mia Wasikowska and John Turturro.

Also awarded funding is Grimur Hakonarson’s The County, a drama set in rural Iceland about a widowed middle-aged cow farmer. As with Hakonarson’s Un Certain Regard-winning Rams, New Europe is handling sales on the project.

Separately, through the Distribution Support Programme, Eurimages is backing 18 requests from 13 distributors, totalling €171,675, with titles coming from Switzerland, Russia, Turkey and Canada.

Eurimages film projects

We would love to thank the author of this article for this incredible content

Eurimages backs projects from Mia Hansen-Løve, ‘Rams’ director

" ["date_timestamp"]=> int(1643260790) } [7]=> array(11) { ["title"]=> string(88) "Boris Johnson, isolé, est confronté à une enquête de police sur le « partygate »" ["link"]=> string(107) "https://firstmediamarketing.com/boris-johnson-isole-est-confronte-a-une-enquete-de-police-sur-le-partygate/" ["dc"]=> array(1) { ["creator"]=> string(12) "Paula Hooper" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 05:12:29 +0000" ["category"]=> string(70) "World NewsBorisconfrontéenquêteestisoléJohnsonpartygatepolicesurune" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10039" ["description"]=> string(708) "Le premier ministre britannique, Boris Johnson, rentre à Downing Street, à Londres, le 25 janvier 2022. HENRY NICHOLLS / REUTERS Boris Johnson sera-t-il encore premier ministre à la fin de cette semaine, dans un mois, dans un an ? Plus personne ne prétend avoir une réponse définitive à cette question pressante dans les allées du pouvoir ... Read more" ["content"]=> array(1) { ["encoded"]=> string(4898) "

Boris Johnson sera-t-il encore premier ministre à la fin de cette semaine, dans un mois, dans un an ? Plus personne ne prétend avoir une réponse définitive à cette question pressante dans les allées du pouvoir britannique, tant les révélations et les coups de théâtre s’accumulent autour du « partygate », le scandale des fêtes données à Downing Street en plein confinement.

Mardi 25 janvier, contre toute attente, Cressida Dick, la chef de la Metropolitan Police (« Met », la police du Grand Londres), a annoncé le lancement d’une enquête sur ces fêtes, pots de départ et autres réunions de travail alcoolisées, qui se sont succédé dans la rue la plus connue du pays, quand l’essentiel des Britanniques respectaient les restrictions sociales.

« Je peux vous confirmer qu’en raison des informations transmises par le Cabinet Office [l’administration travaillant directement pour le premier ministre] et des propres évaluations de mes officiers, la police de Londres enquête désormais sur un certain nombre d’événements qui ont eu lieu à Downing Street et à Whitehall [les ministères], ces deux dernières années, et qui pourraient [s’être tenus] en violation des lois sanitaires », a déclaré Mme Dick, mardi matin, lors d’une réunion de l’Assemblée de Londres. Les investigations seront dirigées par la commandante de police Jane Connors.

Lire aussi Article réservé à nos abonnés Un an de dérive au 10 Downing Street

Scotland Yard en mission au cœur du réacteur politique britannique ? Ce développement n’a rien de banal, mais il existe un précédent. En 2006, des ministres et le premier ministre travailliste Tony Blair avaient été interrogés dans le cadre d’une enquête policière sur le scandale « cash for honours » – le chef du gouvernement avait été entendu en tant que témoin. A l’époque, le Parti travailliste était soupçonné d’avoir mis en place un système remerciant ses donateurs avec des nominations honorifiques. L’enquête n’avait cependant abouti à aucune mise en examen ni condamnation.

Boris Johnson face à un danger « mortel »

Malgré les révélations de la presse qui s’accumulaient, la « Met » avait jusqu’à présent refusé d’enquêter à Downing Street, alors qu’elle n’avait pas hésité à poursuivre des citoyens britanniques convaincus d’avoir enfreint les règles sanitaires – pas de réunions à plus de deux personnes en extérieur jusqu’à fin juin 2020, et pas plus de six à partir de septembre 2020 jusqu’au printemps 2021. Cette attitude a soulevé de vives critiques, notamment du Good Law Project, une ONG spécialisée dans les actions légales contre la corruption. « La décision [de la  « Met »] de ne pas enquêter sur les histoires de fêtes à Downing Street pourrait être illégale, et nous pourrions la poursuivre, à moins qu’elle ne revienne sur sa décision ou explique de manière convaincante les raisons de son refus », expliquait l’ONG, il y a quelques jours.

Il vous reste 60.88% de cet article à lire. La suite est réservée aux abonnés.

We want to say thanks to the writer of this short article for this outstanding material

Boris Johnson, isolé, est confronté à une enquête de police sur le « partygate »

" } ["summary"]=> string(708) "Le premier ministre britannique, Boris Johnson, rentre à Downing Street, à Londres, le 25 janvier 2022. HENRY NICHOLLS / REUTERS Boris Johnson sera-t-il encore premier ministre à la fin de cette semaine, dans un mois, dans un an ? Plus personne ne prétend avoir une réponse définitive à cette question pressante dans les allées du pouvoir ... Read more" ["atom_content"]=> string(4898) "

Boris Johnson sera-t-il encore premier ministre à la fin de cette semaine, dans un mois, dans un an ? Plus personne ne prétend avoir une réponse définitive à cette question pressante dans les allées du pouvoir britannique, tant les révélations et les coups de théâtre s’accumulent autour du « partygate », le scandale des fêtes données à Downing Street en plein confinement.

Mardi 25 janvier, contre toute attente, Cressida Dick, la chef de la Metropolitan Police (« Met », la police du Grand Londres), a annoncé le lancement d’une enquête sur ces fêtes, pots de départ et autres réunions de travail alcoolisées, qui se sont succédé dans la rue la plus connue du pays, quand l’essentiel des Britanniques respectaient les restrictions sociales.

« Je peux vous confirmer qu’en raison des informations transmises par le Cabinet Office [l’administration travaillant directement pour le premier ministre] et des propres évaluations de mes officiers, la police de Londres enquête désormais sur un certain nombre d’événements qui ont eu lieu à Downing Street et à Whitehall [les ministères], ces deux dernières années, et qui pourraient [s’être tenus] en violation des lois sanitaires », a déclaré Mme Dick, mardi matin, lors d’une réunion de l’Assemblée de Londres. Les investigations seront dirigées par la commandante de police Jane Connors.

Lire aussi Article réservé à nos abonnés Un an de dérive au 10 Downing Street

Scotland Yard en mission au cœur du réacteur politique britannique ? Ce développement n’a rien de banal, mais il existe un précédent. En 2006, des ministres et le premier ministre travailliste Tony Blair avaient été interrogés dans le cadre d’une enquête policière sur le scandale « cash for honours » – le chef du gouvernement avait été entendu en tant que témoin. A l’époque, le Parti travailliste était soupçonné d’avoir mis en place un système remerciant ses donateurs avec des nominations honorifiques. L’enquête n’avait cependant abouti à aucune mise en examen ni condamnation.

Boris Johnson face à un danger « mortel »

Malgré les révélations de la presse qui s’accumulaient, la « Met » avait jusqu’à présent refusé d’enquêter à Downing Street, alors qu’elle n’avait pas hésité à poursuivre des citoyens britanniques convaincus d’avoir enfreint les règles sanitaires – pas de réunions à plus de deux personnes en extérieur jusqu’à fin juin 2020, et pas plus de six à partir de septembre 2020 jusqu’au printemps 2021. Cette attitude a soulevé de vives critiques, notamment du Good Law Project, une ONG spécialisée dans les actions légales contre la corruption. « La décision [de la  « Met »] de ne pas enquêter sur les histoires de fêtes à Downing Street pourrait être illégale, et nous pourrions la poursuivre, à moins qu’elle ne revienne sur sa décision ou explique de manière convaincante les raisons de son refus », expliquait l’ONG, il y a quelques jours.

Il vous reste 60.88% de cet article à lire. La suite est réservée aux abonnés.

We want to say thanks to the writer of this short article for this outstanding material

Boris Johnson, isolé, est confronté à une enquête de police sur le « partygate »

" ["date_timestamp"]=> int(1643260349) } [8]=> array(11) { ["title"]=> string(65) "Novel brainstem circuit gives rise to the rhythms of vocalization" ["link"]=> string(98) "https://firstmediamarketing.com/novel-brainstem-circuit-gives-rise-to-the-rhythms-of-vocalization/" ["dc"]=> array(1) { ["creator"]=> string(12) "Tony Grantly" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 04:49:29 +0000" ["category"]=> string(57) "Health And Sciencebrainstemcircuitrhythmsrisevocalization" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10034" ["description"]=> string(687) "Journal Reference: Xin Paul Wei, Matthew Collie, Bowen Dempsey, Gilles Fortin, Kevin Yackle. A novel reticular node in the brainstem synchronizes neonatal mouse crying with breathing. Neuron, 2022; DOI: 10.1016/j.neuron.2021.12.014 “Just to laugh or shout, the body has to coordinate about 100 different muscles in a rhythmic pattern within a single breath,” said Kevin Yackle, ... Read more" ["content"]=> array(1) { ["encoded"]=> string(3833) "

Journal Reference:

  1. Xin Paul Wei, Matthew Collie, Bowen Dempsey, Gilles Fortin, Kevin Yackle. A novel reticular node in the brainstem synchronizes neonatal mouse crying with breathing. Neuron, 2022; DOI: 10.1016/j.neuron.2021.12.014

“Just to laugh or shout, the body has to coordinate about 100 different muscles in a rhythmic pattern within a single breath,” said Kevin Yackle, MD, PhD, a Sandler Faculty Fellow and senior author of the study published online Jan. 7, 2022, in Neuron. “We discovered the neurons that, when switched on, give us this unconscious ability.”

It’s been widely understood that many animals, including humans, have innate control of breathing — you don’t have to use your brain to do it. Yackle and his team suspected that the same control exists for innate vocalizations.

To confirm the existence of this brain circuit, Yackle and his team studied the sounds made by baby mice when they were separated from their mothers. The babies’ cries had a recognizable pattern associated with specific muscle movements. The researchers then determined which cells in the brain stem were responsible for this rhythm, which turned out to be a previously unknown circuit that appears to control the breath and coordinate the muscles needed to produce the vocal sounds.

Identifying this system will enable scientists to ask new questions about how we speak and why some people have trouble doing it.

A New Perspective on Speech Pathologies

“It could be that when we’re learning to speak, we’re learning to either bypass this system or to directly control it,” Yackle said. “Altered wiring in this pattern-generating system could cause speech pathologies.”

Yackle and his team are intrigued by studies suggesting that early in their lives, children with autism innately produce different kinds of sounds than other children do. Some children with autism are either unable to speak or have difficulty producing and understanding the tones and rhythms of speech.

Yackle and his team are intrigued by studies suggesting that early in their lives, children with autism innately produce different kinds of sounds than other children do. Some children with autism are either unable to speak or have difficulty producing and understanding the tones and rhythms of speech.

Such speech pathologies are often viewed as an inability to learn how to talk, said Yackle. He is flipping that perspective on its head, asking whether the speech problems are less about learning and more about the brain circuit controlling speech.

“A child may be hearing and learning language, but if the system that allows them to vocalize is different in some way, they just may not be able to coordinate the breath and movements to make the sounds,” he said. “If we know how that system is different, it might change how we’d teach some people to speak.”

This research was supported in part by NIH grants F30AI147364, T32GM007618, T32AI007334, R01AR077553, and R01AR071944.

We would love to say thanks to the author of this write-up for this incredible content

Novel brainstem circuit gives rise to the rhythms of vocalization

" } ["summary"]=> string(687) "Journal Reference: Xin Paul Wei, Matthew Collie, Bowen Dempsey, Gilles Fortin, Kevin Yackle. A novel reticular node in the brainstem synchronizes neonatal mouse crying with breathing. Neuron, 2022; DOI: 10.1016/j.neuron.2021.12.014 “Just to laugh or shout, the body has to coordinate about 100 different muscles in a rhythmic pattern within a single breath,” said Kevin Yackle, ... Read more" ["atom_content"]=> string(3833) "

Journal Reference:

  1. Xin Paul Wei, Matthew Collie, Bowen Dempsey, Gilles Fortin, Kevin Yackle. A novel reticular node in the brainstem synchronizes neonatal mouse crying with breathing. Neuron, 2022; DOI: 10.1016/j.neuron.2021.12.014

“Just to laugh or shout, the body has to coordinate about 100 different muscles in a rhythmic pattern within a single breath,” said Kevin Yackle, MD, PhD, a Sandler Faculty Fellow and senior author of the study published online Jan. 7, 2022, in Neuron. “We discovered the neurons that, when switched on, give us this unconscious ability.”

It’s been widely understood that many animals, including humans, have innate control of breathing — you don’t have to use your brain to do it. Yackle and his team suspected that the same control exists for innate vocalizations.

To confirm the existence of this brain circuit, Yackle and his team studied the sounds made by baby mice when they were separated from their mothers. The babies’ cries had a recognizable pattern associated with specific muscle movements. The researchers then determined which cells in the brain stem were responsible for this rhythm, which turned out to be a previously unknown circuit that appears to control the breath and coordinate the muscles needed to produce the vocal sounds.

Identifying this system will enable scientists to ask new questions about how we speak and why some people have trouble doing it.

A New Perspective on Speech Pathologies

“It could be that when we’re learning to speak, we’re learning to either bypass this system or to directly control it,” Yackle said. “Altered wiring in this pattern-generating system could cause speech pathologies.”

Yackle and his team are intrigued by studies suggesting that early in their lives, children with autism innately produce different kinds of sounds than other children do. Some children with autism are either unable to speak or have difficulty producing and understanding the tones and rhythms of speech.

Yackle and his team are intrigued by studies suggesting that early in their lives, children with autism innately produce different kinds of sounds than other children do. Some children with autism are either unable to speak or have difficulty producing and understanding the tones and rhythms of speech.

Such speech pathologies are often viewed as an inability to learn how to talk, said Yackle. He is flipping that perspective on its head, asking whether the speech problems are less about learning and more about the brain circuit controlling speech.

“A child may be hearing and learning language, but if the system that allows them to vocalize is different in some way, they just may not be able to coordinate the breath and movements to make the sounds,” he said. “If we know how that system is different, it might change how we’d teach some people to speak.”

This research was supported in part by NIH grants F30AI147364, T32GM007618, T32AI007334, R01AR077553, and R01AR071944.

We would love to say thanks to the author of this write-up for this incredible content

Novel brainstem circuit gives rise to the rhythms of vocalization

" ["date_timestamp"]=> int(1643258969) } [9]=> array(11) { ["title"]=> string(46) "Catalyst surface analysed at atomic resolution" ["link"]=> string(79) "https://firstmediamarketing.com/catalyst-surface-analysed-at-atomic-resolution/" ["dc"]=> array(1) { ["creator"]=> string(12) "Tony Grantly" } ["pubdate"]=> string(31) "Thu, 27 Jan 2022 03:32:25 +0000" ["category"]=> string(57) "Health And ScienceanalysedatomicCatalystresolutionsurface" ["guid"]=> string(40) "https://firstmediamarketing.com/?p=10029" ["description"]=> string(662) "Journal Reference: Weikai Xiang, Nating Yang, Xiaopeng Li, Julia Linnemann, Ulrich Hagemann, Olaf Ruediger, Markus Heidelmann, Tobias Falk, Matteo Aramini, Serena DeBeer, Martin Muhler, Kristina Tschulik, Tong Li. 3D atomic-scale imaging of mixed Co-Fe spinel oxide nanoparticles during oxygen evolution reaction. Nature Communications, 2022; 13 (1) DOI: 10.1038/s41467-021-27788-2 At RUB, a team headed by Weikai ... Read more" ["content"]=> array(1) { ["encoded"]=> string(3485) "

Journal Reference:

  1. Weikai Xiang, Nating Yang, Xiaopeng Li, Julia Linnemann, Ulrich Hagemann, Olaf Ruediger, Markus Heidelmann, Tobias Falk, Matteo Aramini, Serena DeBeer, Martin Muhler, Kristina Tschulik, Tong Li. 3D atomic-scale imaging of mixed Co-Fe spinel oxide nanoparticles during oxygen evolution reaction. Nature Communications, 2022; 13 (1) DOI: 10.1038/s41467-021-27788-2

At RUB, a team headed by Weikai Xiang and Professor Tong Li from Atomic-scale Characterisation worked together with the Chair of Electrochemistry and Nanoscale Materials and the Chair of Industrial Chemistry. Institutes in Shanghai, China, and Didcot, UK, were also involved. The team presents their findings in the journal Nature Communications, published online on 10 January 2022.

Particles observed during the catalysis process

The researchers studied two different types of nanoparticles made of cobalt iron oxide that were around ten nanometres. They analysed the particles during the catalysis of the so-called oxygen evolution reaction. This is a half reaction that occurs during water splitting for hydrogen production: hydrogen can be obtained by splitting water using electrical energy; hydrogen and oxygen are produced in the process. The bottleneck in the development of more efficient production processes is the partial reaction in which oxygen is formed, i.e. the oxygen evolution reaction. This reaction changes the catalyst surface that becomes inactive over time. The structural and compositional changes on the surface play a decisive role in the activity and stability of the electrocatalysts.

For small nanoparticles with a size around ten nanometres, achieving detailed information about what happens on the catalyst surface during the reaction remains a challenge. Using atom probe tomography, the group successfully visualised the distribution of the different types of atoms in the cobalt iron oxide catalysts in three dimensions. By combining it with other methods, they showed how the structure and composition of the surface changed during the catalysis process — and how this change affected the catalytic performance.

“Atom probe tomography has enormous potential to provide atomic insights into the compositional changes on the surface of catalyst nanoparticles during important catalytic reactions such as oxygen evolution reaction for hydrogen production or CO2 reduction,” concludes Tong Li.

We want to say thanks to the writer of this short article for this outstanding content

Catalyst surface analysed at atomic resolution

" } ["summary"]=> string(662) "Journal Reference: Weikai Xiang, Nating Yang, Xiaopeng Li, Julia Linnemann, Ulrich Hagemann, Olaf Ruediger, Markus Heidelmann, Tobias Falk, Matteo Aramini, Serena DeBeer, Martin Muhler, Kristina Tschulik, Tong Li. 3D atomic-scale imaging of mixed Co-Fe spinel oxide nanoparticles during oxygen evolution reaction. Nature Communications, 2022; 13 (1) DOI: 10.1038/s41467-021-27788-2 At RUB, a team headed by Weikai ... Read more" ["atom_content"]=> string(3485) "

Journal Reference:

  1. Weikai Xiang, Nating Yang, Xiaopeng Li, Julia Linnemann, Ulrich Hagemann, Olaf Ruediger, Markus Heidelmann, Tobias Falk, Matteo Aramini, Serena DeBeer, Martin Muhler, Kristina Tschulik, Tong Li. 3D atomic-scale imaging of mixed Co-Fe spinel oxide nanoparticles during oxygen evolution reaction. Nature Communications, 2022; 13 (1) DOI: 10.1038/s41467-021-27788-2

At RUB, a team headed by Weikai Xiang and Professor Tong Li from Atomic-scale Characterisation worked together with the Chair of Electrochemistry and Nanoscale Materials and the Chair of Industrial Chemistry. Institutes in Shanghai, China, and Didcot, UK, were also involved. The team presents their findings in the journal Nature Communications, published online on 10 January 2022.

Particles observed during the catalysis process

The researchers studied two different types of nanoparticles made of cobalt iron oxide that were around ten nanometres. They analysed the particles during the catalysis of the so-called oxygen evolution reaction. This is a half reaction that occurs during water splitting for hydrogen production: hydrogen can be obtained by splitting water using electrical energy; hydrogen and oxygen are produced in the process. The bottleneck in the development of more efficient production processes is the partial reaction in which oxygen is formed, i.e. the oxygen evolution reaction. This reaction changes the catalyst surface that becomes inactive over time. The structural and compositional changes on the surface play a decisive role in the activity and stability of the electrocatalysts.

For small nanoparticles with a size around ten nanometres, achieving detailed information about what happens on the catalyst surface during the reaction remains a challenge. Using atom probe tomography, the group successfully visualised the distribution of the different types of atoms in the cobalt iron oxide catalysts in three dimensions. By combining it with other methods, they showed how the structure and composition of the surface changed during the catalysis process — and how this change affected the catalytic performance.

“Atom probe tomography has enormous potential to provide atomic insights into the compositional changes on the surface of catalyst nanoparticles during important catalytic reactions such as oxygen evolution reaction for hydrogen production or CO2 reduction,” concludes Tong Li.

We want to say thanks to the writer of this short article for this outstanding content

Catalyst surface analysed at atomic resolution

" ["date_timestamp"]=> int(1643254345) } } ["channel"]=> array(7) { ["title"]=> string(21) "First Media Marketing" ["link"]=> string(31) "https://firstmediamarketing.com" ["lastbuilddate"]=> string(31) "Thu, 27 Jan 2022 07:40:36 +0000" ["language"]=> string(5) "en-US" ["sy"]=> array(2) { ["updateperiod"]=> string(9) " hourly " ["updatefrequency"]=> string(4) " 1 " } ["generator"]=> string(28) "https://wordpress.org/?v=5.9" ["tagline"]=> NULL } ["textinput"]=> array(0) { } ["image"]=> array(0) { } ["feed_type"]=> string(3) "RSS" ["feed_version"]=> string(3) "2.0" ["encoding"]=> string(5) "UTF-8" ["_source_encoding"]=> string(0) "" ["ERROR"]=> string(0) "" ["WARNING"]=> string(0) "" ["_CONTENT_CONSTRUCTS"]=> array(6) { [0]=> string(7) "content" [1]=> string(7) "summary" [2]=> string(4) "info" [3]=> string(5) "title" [4]=> string(7) "tagline" [5]=> string(9) "copyright" } ["_KNOWN_ENCODINGS"]=> array(3) { [0]=> string(5) "UTF-8" [1]=> string(8) "US-ASCII" [2]=> string(10) "ISO-8859-1" } ["stack"]=> array(0) { } ["inchannel"]=> bool(false) ["initem"]=> bool(false) ["incontent"]=> bool(false) ["intextinput"]=> bool(false) ["inimage"]=> bool(false) ["current_namespace"]=> bool(false) ["last_modified"]=> string(31) "Thu, 27 Jan 2022 07:58:44 GMT " ["etag"]=> string(29) "hb4J31uc5sa/ItJK05eDu6HaQwQ " }